![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
![]() | Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
![]() | Protein automated matches [190256] (6 species) not a true protein |
![]() | Species Actinomycete (Rhodococcus erythropolis) [187295] (1 PDB entry) |
![]() | Domain d2qdya_: 2qdy A: [150674] Other proteins in same PDB: d2qdyb_ automated match to d2ahja_ complexed with cl, fe, gol, ibn, mg |
PDB Entry: 2qdy (more details), 1.3 Å
SCOPe Domain Sequences for d2qdya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdya_ d.149.1.1 (A:) automated matches {Actinomycete (Rhodococcus erythropolis)} enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe ivtkdcligvaipqvpt
Timeline for d2qdya_: