Lineage for d2qdya_ (2qdy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987858Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2987859Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2987860Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2987880Protein automated matches [190256] (6 species)
    not a true protein
  7. 2987881Species Actinomycete (Rhodococcus erythropolis) [187295] (1 PDB entry)
  8. 2987882Domain d2qdya_: 2qdy A: [150674]
    Other proteins in same PDB: d2qdyb_
    automated match to d2ahja_
    complexed with cl, fe, gol, ibn, mg

Details for d2qdya_

PDB Entry: 2qdy (more details), 1.3 Å

PDB Description: crystal structure of fe-type nhase from rhodococcus erythropolis aj270
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2qdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdya_ d.149.1.1 (A:) automated matches {Actinomycete (Rhodococcus erythropolis)}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

SCOPe Domain Coordinates for d2qdya_:

Click to download the PDB-style file with coordinates for d2qdya_.
(The format of our PDB-style files is described here.)

Timeline for d2qdya_: