Lineage for d2qdta_ (2qdt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2602908Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2603041Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2603055Domain d2qdta_: 2qdt A: [150673]
    automated match to d1smla_
    complexed with i38, so4, zn

Details for d2qdta_

PDB Entry: 2qdt (more details), 2 Å

PDB Description: Structural Basis for the Broad-Spectrum Inhibition of Metallo-{Beta}-Lactamases: L1- IS38 Complex
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2qdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2qdta_:

Click to download the PDB-style file with coordinates for d2qdta_.
(The format of our PDB-style files is described here.)

Timeline for d2qdta_: