Lineage for d2qdhc_ (2qdh C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098948Species Trypanosome (Leishmania mexicana) [TaxId:5665] [255557] (3 PDB entries)
  8. 2098955Domain d2qdhc_: 2qdh C: [150668]
    automated match to d2alda_
    complexed with m2p

Details for d2qdhc_

PDB Entry: 2qdh (more details), 1.9 Å

PDB Description: fructose-1,6-bisphosphate aldolase from leishmania mexicana in complex with mannitol-1,6-bisphosphate, a competitive inhibitor
PDB Compounds: (C:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d2qdhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdhc_ c.1.10.0 (C:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsddd

SCOPe Domain Coordinates for d2qdhc_:

Click to download the PDB-style file with coordinates for d2qdhc_.
(The format of our PDB-style files is described here.)

Timeline for d2qdhc_: