SCOP 1.75: Domain d2qdgd1: 2qdg D:1-357

Lineage for d2qdgd1 (2qdg D:1-357)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51582] (4 PDB entries)

8. Domain d2qdgd1: 2qdg D:1-357 [150665]
   automatically matched to d1epxa_
   complexed with 2fp, po4

Details for d2qdgd1

PDB Entry: 2qdg, 2.2 Å

PDB Description: fructose-1,6-bisphosphate schiff base intermediate in fbp aldolase from leishmania mexicana

PDB Compounds: (D:) fructose-1,6-bisphosphate aldolase

SCOP Domain Sequences for d2qdgd1:

Sequence; same for both SEQRES and ATOM records:

>d2qdgd1 c.1.10.1 (D:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd

Timeline for d2qdgd1:

• d2qdgd1 is new in SCOP 1.75
  
• d2qdgd1 appears in SCOPe 2.01
  
• d2qdgd1 appears in the current release, SCOPe 2.08, called d2qdgd_