Lineage for d2qcba2 (2qcb A:14-134)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073250Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2073570Protein automated matches [190191] (2 species)
    not a true protein
  7. 2073663Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)
  8. 2073708Domain d2qcba2: 2qcb A:14-134 [150653]
    Other proteins in same PDB: d2qcba3
    automated match to d4ekva_
    complexed with kys

Details for d2qcba2

PDB Entry: 2qcb (more details), 1.65 Å

PDB Description: t7-tagged full-length streptavidin complexed with ruthenium ligand
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2qcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qcba2 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltkgtteanawkstlvghdtftkv
k

SCOPe Domain Coordinates for d2qcba2:

Click to download the PDB-style file with coordinates for d2qcba2.
(The format of our PDB-style files is described here.)

Timeline for d2qcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qcba3