Lineage for d2qc1a_ (2qc1 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259071Protein Bungarotoxin [57324] (4 species)
  7. 2259072Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 2259075Domain d2qc1a_: 2qc1 A: [150650]
    Other proteins in same PDB: d2qc1b1, d2qc1b2
    automated match to d1hc9a_

Details for d2qc1a_

PDB Entry: 2qc1 (more details), 1.94 Å

PDB Description: crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution
PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d2qc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qc1a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d2qc1a_:

Click to download the PDB-style file with coordinates for d2qc1a_.
(The format of our PDB-style files is described here.)

Timeline for d2qc1a_: