SCOP 1.75: Domain d2qc1a1: 2qc1 A:1-74

Lineage for d2qc1a1 (2qc1 A:1-74)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.1: Snake venom toxins [57303] (27 proteins)

6. Protein Bungarotoxin [57324] (4 species)

7. Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (22 PDB entries)

8. Domain d2qc1a1: 2qc1 A:1-74 [150650]
   automatically matched to d1hc9a_
   complexed with man, nag; mutant

Details for d2qc1a1

PDB Entry: 2qc1, 1.94 Å

PDB Description: crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution

PDB Compounds: (A:) alpha-bungarotoxin

SCOP Domain Sequences for d2qc1a1:

Sequence; same for both SEQRES and ATOM records:

>d2qc1a1 g.7.1.1 (A:1-74) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdvfcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

Timeline for d2qc1a1:

• d2qc1a1 is new in SCOP 1.75
  
• d2qc1a1 is called d2qc1a_ in SCOPe 2.01
  
• d2qc1a1 appears in the current release, SCOPe 2.08, called d2qc1a_