Lineage for d2qbki1 (2qbk I:73-141)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080806Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1080807Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1080808Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1080826Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 1080843Domain d2qbki1: 2qbk I:73-141 [150630]
    Other proteins in same PDB: d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbk61, d2qbkc1, d2qbkc2, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1
    automatically matched to 2AW4 I:73-141
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbki1

PDB Entry: 2qbk (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qbki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbki1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2qbki1:

Click to download the PDB-style file with coordinates for d2qbki1.
(The format of our PDB-style files is described here.)

Timeline for d2qbki1: