Lineage for d2qbk61 (2qbk 6:1-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199618Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2199663Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2199664Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2199665Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2199681Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 2199688Domain d2qbk61: 2qbk 6:1-185 [150620]
    Other proteins in same PDB: d2qbk01, d2qbk11, d2qbk31, d2qbk41, d2qbkc1, d2qbkc2, d2qbkd1, d2qbke1, d2qbkf1, d2qbkg1, d2qbkg2, d2qbkh1, d2qbkh2, d2qbki1, d2qbki2, d2qbkj1, d2qbkk1, d2qbkl1, d2qbkm1, d2qbkn1, d2qbko1, d2qbkp1, d2qbkq1, d2qbkr1, d2qbks1, d2qbkt1, d2qbku1, d2qbkv1, d2qbkw1, d2qbkx1, d2qbky1, d2qbkz1
    protein/RNA complex; complexed with lll, mg, zn
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbk61

PDB Entry: 2qbk (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (6:) 50S ribosomal protein RRF

SCOPe Domain Sequences for d2qbk61:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbk61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOPe Domain Coordinates for d2qbk61:

Click to download the PDB-style file with coordinates for d2qbk61.
(The format of our PDB-style files is described here.)

Timeline for d2qbk61: