Lineage for d1ch9a1 (1ch9 A:1-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688286Domain d1ch9a1: 1ch9 A:1-153 [15062]
    Other proteins in same PDB: d1ch9a2
    complexed with hem, so4; mutant

Details for d1ch9a1

PDB Entry: 1ch9 (more details), 1.8 Å

PDB Description: recombinant sperm whale myoglobin h97q mutant (met)
PDB Compounds: (A:) protein (myoglobin)

SCOPe Domain Sequences for d1ch9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ch9a1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkqkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1ch9a1:

Click to download the PDB-style file with coordinates for d1ch9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ch9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ch9a2