Lineage for d2qbju1 (2qbj U:3-53)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975666Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1975667Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1975668Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1975669Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1975670Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1975692Domain d2qbju1: 2qbj U:3-53 [150615]
    Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1
    protein/RNA complex; complexed with lll, mg
    protein/RNA complex; complexed with lll, mg

Details for d2qbju1

PDB Entry: 2qbj (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qbju1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbju1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2qbju1:

Click to download the PDB-style file with coordinates for d2qbju1.
(The format of our PDB-style files is described here.)

Timeline for d2qbju1: