SCOPe 2.05: Domain d2qbjn1: 2qbj N:1-100

Lineage for d2qbjn1 (2qbj N:1-100)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
   Uniprot P02370 1-100

8. Domain d2qbjn1: 2qbj N:1-100 [150609]
   Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1, d2qbju1
   protein/RNA complex; complexed with lll, mg
   protein/RNA complex; complexed with lll, mg

Details for d2qbjn1

PDB Entry: 2qbj, 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2qbjn1:

Sequence, based on SEQRES records:

>d2qbjn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records):

>d2qbjn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

Timeline for d2qbjn1:

• d2qbjn1 first appeared in SCOP 1.75
  
• d2qbjn1 appears in SCOPe 2.04
  
• d2qbjn1 appears in SCOPe 2.06
  
• d2qbjn1 appears in the current release, SCOPe 2.08