Lineage for d2qbji1 (2qbj I:3-129)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891700Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1891810Protein Ribosomal protein S9 [54218] (2 species)
  7. 1891811Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 1891833Domain d2qbji1: 2qbj I:3-129 [150604]
    Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1, d2qbju1
    protein/RNA complex; complexed with lll, mg
    protein/RNA complex; complexed with lll, mg

Details for d2qbji1

PDB Entry: 2qbj (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2qbji1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbji1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
rpqfskr

SCOPe Domain Coordinates for d2qbji1:

Click to download the PDB-style file with coordinates for d2qbji1.
(The format of our PDB-style files is described here.)

Timeline for d2qbji1: