![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (9 species) |
![]() | Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries) |
![]() | Domain d1ltw__: 1ltw - [15060] complexed with hem, oxy, so4; mutant |
PDB Entry: 1ltw (more details), 1.7 Å
SCOP Domain Sequences for d1ltw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltw__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)} mvlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkase dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh pgnfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d1ltw__: