Lineage for d1ltw__ (1ltw -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531626Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 531672Domain d1ltw__: 1ltw - [15060]
    complexed with hem, oxy, so4; mutant

Details for d1ltw__

PDB Entry: 1ltw (more details), 1.7 Å

PDB Description: recombinant sperm whale myoglobin 29w mutant (oxy)

SCOP Domain Sequences for d1ltw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltw__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1ltw__:

Click to download the PDB-style file with coordinates for d1ltw__.
(The format of our PDB-style files is described here.)

Timeline for d1ltw__: