![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
![]() | Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
![]() | Protein Ribosomal protein L16p [117889] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [143200] (29 PDB entries) Uniprot P0ADY7 1-136 |
![]() | Domain d2qbim1: 2qbi M:1-136 [150581] Other proteins in same PDB: d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 protein/RNA complex; complexed with lll, mg, zn protein/RNA complex; complexed with lll, mg, zn |
PDB Entry: 2qbi (more details), 4 Å
SCOPe Domain Sequences for d2qbim1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbim1 d.41.4.2 (M:1-136) Ribosomal protein L16p {Escherichia coli [TaxId: 562]} mlqpkrtkfrkmhkgrnrglaqgtdvsfgsfglkavgrgrltarqieaarramtravkrq gkiwirvfpdkpitekplavrmgkgkgnveywvaliqpgkvlyemdgvpeelareafkla aaklpikttfvtktvm
Timeline for d2qbim1:
![]() Domains from other chains: (mouse over for more information) d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 |