Lineage for d2qbig2 (2qbi G:82-176)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873804Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 873830Domain d2qbig2: 2qbi G:82-176 [150573]
    Other proteins in same PDB: d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1
    automatically matched to 2AW4 G:82-176
    complexed with lll, mg, zn

Details for d2qbig2

PDB Entry: 2qbi (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2qbig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbig2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOP Domain Coordinates for d2qbig2:

Click to download the PDB-style file with coordinates for d2qbig2.
(The format of our PDB-style files is described here.)

Timeline for d2qbig2: