![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Escherichia coli [TaxId:562] [159159] (29 PDB entries) Uniprot P60438 1-209 |
![]() | Domain d2qbid1: 2qbi D:1-209 [150569] Other proteins in same PDB: d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 automatically matched to 2AW4 D:1-209 complexed with lll, mg, zn |
PDB Entry: 2qbi (more details), 4 Å
SCOP Domain Sequences for d2qbid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbid1 b.43.3.2 (D:1-209) Ribosomal protein L3 {Escherichia coli [TaxId: 562]} miglvgkkvgmtriftedgvsipvtvieveanrvtqvkdlandgyraiqvttgakkanrv tkpeaghfakagveagrglwefrlaegeeftvgqsisvelfadvkkvdvtgtskgkgfag tvkrwnfrtqdathgnslshrvpgsigqnqtpgkvfkgkkmagqmgnervtvqsldvvrv daernlllvkgavpgatgsdlivkpavka
Timeline for d2qbid1:
![]() Domains from other chains: (mouse over for more information) d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 |