Lineage for d2qbhr1 (2qbh R:19-73)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723549Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1723550Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1723551Protein Ribosomal protein S18 [46913] (2 species)
  7. 1723552Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1723573Domain d2qbhr1: 2qbh R:19-73 [150558]
    Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhs1, d2qbht1, d2qbhu1
    protein/RNA complex; complexed with lll, mg
    protein/RNA complex; complexed with lll, mg

Details for d2qbhr1

PDB Entry: 2qbh (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qbhr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbhr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2qbhr1:

Click to download the PDB-style file with coordinates for d2qbhr1.
(The format of our PDB-style files is described here.)

Timeline for d2qbhr1: