![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
![]() | Domain d2qbhq1: 2qbh Q:3-82 [150557] Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1 automatically matched to 2AVY Q:3-82 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbh (more details), 4 Å
SCOPe Domain Sequences for d2qbhq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbhq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2qbhq1: