Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
Domain d2qbhm1: 2qbh M:1-114 [150554] Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbh (more details), 4 Å
SCOPe Domain Sequences for d2qbhm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbhm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
Timeline for d2qbhm1: