Lineage for d2qbhj1 (2qbh J:5-102)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862993Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 862994Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 862995Protein Ribosomal protein S10 [55001] (2 species)
  7. 862996Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 863013Domain d2qbhj1: 2qbh J:5-102 [150551]
    Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1
    automatically matched to 2AVY J:5-102
    complexed with lll, mg

Details for d2qbhj1

PDB Entry: 2qbh (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2qbhj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbhj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOP Domain Coordinates for d2qbhj1:

Click to download the PDB-style file with coordinates for d2qbhj1.
(The format of our PDB-style files is described here.)

Timeline for d2qbhj1: