Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (2 species) |
Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
Domain d2qbhj1: 2qbh J:5-102 [150551] Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1 automatically matched to 2AVY J:5-102 complexed with lll, mg |
PDB Entry: 2qbh (more details), 4 Å
SCOP Domain Sequences for d2qbhj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbhj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2qbhj1: