Class a: All alpha proteins [46456] (289 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
Domain d2qbhg1: 2qbh G:2-151 [150548] Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbh (more details), 4 Å
SCOPe Domain Sequences for d2qbhg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbhg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2qbhg1: