SCOPe 2.05: Domain d2qbhc1: 2qbh C:1-105

Lineage for d2qbhc1 (2qbh C:1-105)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d2qbhc1: 2qbh C:1-105 [150542]
   Other proteins in same PDB: d2qbhb1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1
   protein/RNA complex; complexed with lll, mg
   protein/RNA complex; complexed with lll, mg

Details for d2qbhc1

PDB Entry: 2qbh, 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qbhc1:

Sequence; same for both SEQRES and ATOM records:

>d2qbhc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d2qbhc1:

• d2qbhc1 first appeared in SCOP 1.75
  
• d2qbhc1 appears in SCOPe 2.04
  
• d2qbhc1 appears in SCOPe 2.06
  
• d2qbhc1 appears in the current release, SCOPe 2.08