SCOPe 2.07: Domain d2qbg61: 2qbg 6:1-185

Lineage for d2qbg61 (2qbg 6:1-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)

6. Protein Ribosome recycling factor, RRF [55196] (7 species)

7. Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)

8. Domain d2qbg61: 2qbg 6:1-185 [150512]
   Other proteins in same PDB: d2qbg01, d2qbg11, d2qbg31, d2qbg41, d2qbgc1, d2qbgc2, d2qbgd1, d2qbge1, d2qbgf1, d2qbgg1, d2qbgg2, d2qbgh1, d2qbgh2, d2qbgi1, d2qbgi2, d2qbgj1, d2qbgk1, d2qbgl1, d2qbgm1, d2qbgn1, d2qbgo1, d2qbgp1, d2qbgq1, d2qbgr1, d2qbgs1, d2qbgt1, d2qbgu1, d2qbgv1, d2qbgw1, d2qbgx1, d2qbgy1, d2qbgz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2qbg61

PDB Entry: 2qbg, 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (6:) ribosome recycling factor

SCOPe Domain Sequences for d2qbg61:

Sequence; same for both SEQRES and ATOM records:

>d2qbg61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

Timeline for d2qbg61:

• d2qbg61 first appeared in SCOP 1.75
  
• d2qbg61 appears in SCOPe 2.06
  
• d2qbg61 appears in the current release, SCOPe 2.08