SCOP 1.69: Domain d1f65a_: 1f65 A:

Lineage for d1f65a_ (1f65 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d1f65a_: 1f65 A: [15051]

Details for d1f65a_

PDB Entry: 1f65, 1.7 Å

PDB Description: crystal structure of oxy sperm whale myoglobin mutant y(b10)q(e7) r(e10)

SCOP Domain Sequences for d1f65a_:

Sequence; same for both SEQRES and ATOM records:

>d1f65a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1f65a_:

• d1f65a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f65a_ appears in SCOP 1.67
  
• d1f65a_ appears in SCOP 1.71
  
• d1f65a_ appears in the current release, SCOPe 2.08