Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Escherichia coli [TaxId:562] [159644] (24 PDB entries) Uniprot P0A7R9 12-128 |
Domain d2qbfk1: 2qbf K:12-128 [150498] Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfi1, d2qbfj1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1 automatically matched to 2AVY K:12-128 complexed with mg |
PDB Entry: 2qbf (more details), 3.3 Å
SCOP Domain Sequences for d2qbfk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbfk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
Timeline for d2qbfk1: