Lineage for d2qbfc1 (2qbf C:1-105)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1904680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1904696Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 1904699Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
    Uniprot P0A7V3 1-105
  8. 1904703Domain d2qbfc1: 2qbf C:1-105 [150488]
    Other proteins in same PDB: d2qbfb1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfi1, d2qbfj1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbfc1

PDB Entry: 2qbf (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qbfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbfc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

SCOPe Domain Coordinates for d2qbfc1:

Click to download the PDB-style file with coordinates for d2qbfc1.
(The format of our PDB-style files is described here.)

Timeline for d2qbfc1: