| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries) Uniprot P02185 |
| Domain d2spla_: 2spl A: [15047] complexed with cmo, hem, so4; mutant |
PDB Entry: 2spl (more details), 1.7 Å
SCOPe Domain Sequences for d2spla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2spla_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d2spla_: