Lineage for d2qbec1 (2qbe C:125-269)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796751Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 796752Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 796804Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 796809Domain d2qbec1: 2qbe C:125-269 [150459]
    Other proteins in same PDB: d2qbe01, d2qbe11, d2qbe31, d2qbe41, d2qbe61, d2qbec2, d2qbed1, d2qbee1, d2qbef1, d2qbeg1, d2qbeg2, d2qbeh1, d2qbeh2, d2qbei1, d2qbei2, d2qbej1, d2qbek1, d2qbel1, d2qbem1, d2qben1, d2qbeo1, d2qbep1, d2qbeq1, d2qber1, d2qbes1, d2qbet1, d2qbeu1, d2qbev1, d2qbew1, d2qbex1, d2qbey1, d2qbez1
    automatically matched to 2AW4 C:125-269
    complexed with mg, zn

Details for d2qbec1

PDB Entry: 2qbe (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d2qbec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbec1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOP Domain Coordinates for d2qbec1:

Click to download the PDB-style file with coordinates for d2qbec1.
(The format of our PDB-style files is described here.)

Timeline for d2qbec1: