Lineage for d2qbe61 (2qbe 6:1-185)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864674Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 864714Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 864715Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 864716Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 864733Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 864737Domain d2qbe61: 2qbe 6:1-185 [150458]
    Other proteins in same PDB: d2qbe01, d2qbe11, d2qbe31, d2qbe41, d2qbec1, d2qbec2, d2qbed1, d2qbee1, d2qbef1, d2qbeg1, d2qbeg2, d2qbeh1, d2qbeh2, d2qbei1, d2qbei2, d2qbej1, d2qbek1, d2qbel1, d2qbem1, d2qben1, d2qbeo1, d2qbep1, d2qbeq1, d2qber1, d2qbes1, d2qbet1, d2qbeu1, d2qbev1, d2qbew1, d2qbex1, d2qbey1, d2qbez1
    automatically matched to d1eh1a_
    complexed with mg, zn

Details for d2qbe61

PDB Entry: 2qbe (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (6:) ribosome recycling factor

SCOP Domain Sequences for d2qbe61:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbe61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOP Domain Coordinates for d2qbe61:

Click to download the PDB-style file with coordinates for d2qbe61.
(The format of our PDB-style files is described here.)

Timeline for d2qbe61: