Lineage for d2qbdt1 (2qbd T:2-86)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310051Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 2310052Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 2310053Protein Ribosomal protein S20 [46994] (2 species)
  7. 2310054Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 2310057Domain d2qbdt1: 2qbd T:2-86 [150452]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbdt1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2qbdt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbdt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2qbdt1:

Click to download the PDB-style file with coordinates for d2qbdt1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdt1: