Lineage for d2qbdp1 (2qbd P:1-82)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186375Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2186376Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2186377Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2186378Protein Ribosomal protein S16 [54567] (3 species)
  7. 2186381Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 2186384Domain d2qbdp1: 2qbd P:1-82 [150448]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbdp1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2qbdp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbdp1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d2qbdp1:

Click to download the PDB-style file with coordinates for d2qbdp1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdp1: