Lineage for d2qbdn1 (2qbd N:1-100)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892700Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 892701Protein Ribosomal protein S14 [57753] (2 species)
  7. 892702Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. 892706Domain d2qbdn1: 2qbd N:1-100 [150447]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    automatically matched to 2AVY N:1-100
    complexed with mg

Details for d2qbdn1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2qbdn1:

Sequence, based on SEQRES records: (download)

>d2qbdn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2qbdn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOP Domain Coordinates for d2qbdn1:

Click to download the PDB-style file with coordinates for d2qbdn1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdn1: