Lineage for d2qbde2 (2qbd E:9-77)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190524Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2190525Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2190606Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
    automatically mapped to Pfam PF00333
  6. 2190607Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 2190610Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
    Uniprot P0A7W1 9-77
  8. 2190613Domain d2qbde2: 2qbd E:9-77 [150438]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbde2

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qbde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbde2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

SCOPe Domain Coordinates for d2qbde2:

Click to download the PDB-style file with coordinates for d2qbde2.
(The format of our PDB-style files is described here.)

Timeline for d2qbde2: