![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159642] (29 PDB entries) Uniprot P0C018 1-117 |
![]() | Domain d2qbco1: 2qbc O:2-117 [150421] Other proteins in same PDB: d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcc2, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1 automatically matched to 2AW4 O:1-117 complexed with lll, mg, zn |
PDB Entry: 2qbc (more details), 3.54 Å
SCOP Domain Sequences for d2qbco1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbco1 c.55.4.1 (O:2-117) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} dkksarirratrarrklqelgatrlvvhrtprhiyaqviapngsevlvaastvekaiaeq lkytgnkdaaaavgkavaeralekgikdvsfdrsgfqyhgrvqaladaareaglqf
Timeline for d2qbco1:
![]() Domains from other chains: (mouse over for more information) d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcc2, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1 |