Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries) |
Domain d104m__: 104m - [15041] complexed with hem, nbn, so4 |
PDB Entry: 104m (more details), 1.71 Å
SCOP Domain Sequences for d104m__:
Sequence; same for both SEQRES and ATOM records: (download)
>d104m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)} vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d104m__: