Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Escherichia coli [TaxId:562] [159086] (27 PDB entries) Uniprot P60422 3-124 |
Domain d2qbcc2: 2qbc C:61-124 [150406] Other proteins in same PDB: d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbco1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1 protein/RNA complex; complexed with lll, mg, zn protein/RNA complex; complexed with lll, mg, zn |
PDB Entry: 2qbc (more details), 3.54 Å
SCOPe Domain Sequences for d2qbcc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbcc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd aaik
Timeline for d2qbcc2:
View in 3D Domains from other chains: (mouse over for more information) d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbco1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1 |