Lineage for d2qbcc2 (2qbc C:61-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399426Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2399436Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2399447Domain d2qbcc2: 2qbc C:61-124 [150406]
    Other proteins in same PDB: d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbco1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1
    protein/RNA complex; complexed with lll, mg, zn
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbcc2

PDB Entry: 2qbc (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 50S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qbcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbcc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d2qbcc2:

Click to download the PDB-style file with coordinates for d2qbcc2.
(The format of our PDB-style files is described here.)

Timeline for d2qbcc2: