Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
Domain d2qbbq1: 2qbb Q:3-82 [150396] Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbr1, d2qbbs1, d2qbbt1, d2qbbu1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbb (more details), 3.54 Å
SCOPe Domain Sequences for d2qbbq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbbq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2qbbq1: