SCOP 1.71: Domain d1cika_: 1cik A:

Lineage for d1cika_ (1cik A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d1cika_: 1cik A: [15039]
   complexed with hem, mto, so4; mutant

Details for d1cika_

PDB Entry: 1cik, 1.7 Å

PDB Description: recombinant sperm whale myoglobin i99a mutant (met)

SCOP Domain Sequences for d1cika_:

Sequence; same for both SEQRES and ATOM records:

>d1cika_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkapikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1cika_:

• d1cika_ first appeared (with stable ids) in SCOP 1.55
  
• d1cika_ appears in SCOP 1.69
  
• d1cika_ appears in SCOP 1.73
  
• d1cika_ appears in the current release, SCOPe 2.08, called d1cika1