Lineage for d1vxf__ (1vxf -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 599Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries)
  8. 620Domain d1vxf__: 1vxf - [15038]

Details for d1vxf__

PDB Entry: 1vxf (more details), 1.7 Å

PDB Description: native sperm whale myoglobin

SCOP Domain Sequences for d1vxf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vxf__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1vxf__:

Click to download the PDB-style file with coordinates for d1vxf__.
(The format of our PDB-style files is described here.)

Timeline for d1vxf__: