Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Escherichia coli [TaxId:562] [159878] (28 PDB entries) Uniprot P02424 1-99 |
Domain d2qbat1: 2qba T:1-93 [150373] Other proteins in same PDB: d2qba01, d2qba11, d2qba31, d2qba41, d2qbac1, d2qbac2, d2qbad1, d2qbae1, d2qbaf1, d2qbag1, d2qbag2, d2qbah1, d2qbah2, d2qbai1, d2qbai2, d2qbaj1, d2qbak1, d2qbal1, d2qbam1, d2qban1, d2qbao1, d2qbap1, d2qbaq1, d2qbar1, d2qbas1, d2qbau1, d2qbav1, d2qbaw1, d2qbax1, d2qbay1, d2qbaz1 automatically matched to 2AW4 T:1-99 complexed with lll, mg, zn |
PDB Entry: 2qba (more details), 3.54 Å
SCOP Domain Sequences for d2qbat1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbat1 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} mireerllkvlraphvsekastameksntivlkvakdatkaeikaavqklfevevevvnt lvvkgkvkrhgqrigrrsdwkkayvtlkegqnl
Timeline for d2qbat1:
View in 3D Domains from other chains: (mouse over for more information) d2qba01, d2qba11, d2qba31, d2qba41, d2qbac1, d2qbac2, d2qbad1, d2qbae1, d2qbaf1, d2qbag1, d2qbag2, d2qbah1, d2qbah2, d2qbai1, d2qbai2, d2qbaj1, d2qbak1, d2qbal1, d2qbam1, d2qban1, d2qbao1, d2qbap1, d2qbaq1, d2qbar1, d2qbas1, d2qbau1, d2qbav1, d2qbaw1, d2qbax1, d2qbay1, d2qbaz1 |