SCOP 1.75: Domain d2qbai1: 2qba I:73-141

Lineage for d2qbai1 (2qba I:73-141)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
   Uniprot P0A7J7 73-141

8. Domain d2qbai1: 2qba I:73-141 [150361]
   Other proteins in same PDB: d2qba01, d2qba11, d2qba31, d2qba41, d2qbac1, d2qbac2, d2qbad1, d2qbae1, d2qbaf1, d2qbag1, d2qbag2, d2qbah1, d2qbah2, d2qbai2, d2qbaj1, d2qbak1, d2qbal1, d2qbam1, d2qban1, d2qbao1, d2qbap1, d2qbaq1, d2qbar1, d2qbas1, d2qbat1, d2qbau1, d2qbav1, d2qbaw1, d2qbax1, d2qbay1, d2qbaz1
   automatically matched to 2AW4 I:73-141
   complexed with lll, mg, zn

Details for d2qbai1

PDB Entry: 2qba, 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 50S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d2qbai1:

Sequence; same for both SEQRES and ATOM records:

>d2qbai1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

Timeline for d2qbai1:

• d2qbai1 is new in SCOP 1.75
  
• d2qbai1 appears in SCOPe 2.01
  
• d2qbai1 appears in the current release, SCOPe 2.08