Lineage for d2qbah2 (2qba H:1-58)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967248Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2967249Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2967250Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2967258Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2967270Domain d2qbah2: 2qba H:1-58 [150360]
    Other proteins in same PDB: d2qba01, d2qba11, d2qba31, d2qba41, d2qbac1, d2qbac2, d2qbad1, d2qbae1, d2qbaf1, d2qbag1, d2qbag2, d2qbah1, d2qbai1, d2qbai2, d2qbaj1, d2qbak1, d2qbal1, d2qbam1, d2qban1, d2qbao1, d2qbap1, d2qbaq1, d2qbar1, d2qbas1, d2qbat1, d2qbau1, d2qbav1, d2qbaw1, d2qbax1, d2qbay1, d2qbaz1
    protein/RNA complex; complexed with lll, mg, zn
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbah2

PDB Entry: 2qba (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 50S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qbah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbah2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2qbah2:

Click to download the PDB-style file with coordinates for d2qbah2.
(The format of our PDB-style files is described here.)

Timeline for d2qbah2: