Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) automatically mapped to Pfam PF01649 |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (2 species) |
Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
Domain d2qb9t1: 2qb9 T:2-86 [150346] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9u1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOPe Domain Sequences for d2qb9t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9t1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa akglihknkaarhkanltaqinkla
Timeline for d2qb9t1: