Class a: All alpha proteins [46456] (284 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
Domain d2qb9g1: 2qb9 G:2-151 [150334] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY G:2-151 complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOP Domain Sequences for d2qb9g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9g1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2qb9g1: