Lineage for d2qb9f1 (2qb9 F:1-100)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416810Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1416811Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1416812Protein Ribosomal protein S6 [54997] (4 species)
  7. 1416815Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1416828Domain d2qb9f1: 2qb9 F:1-100 [150333]
    Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with lll, mg

Details for d2qb9f1

PDB Entry: 2qb9 (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qb9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb9f1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qb9f1:

Click to download the PDB-style file with coordinates for d2qb9f1.
(The format of our PDB-style files is described here.)

Timeline for d2qb9f1: