SCOP 1.75: Domain d2qb9e2: 2qb9 E:9-77

Lineage for d2qb9e2 (2qb9 E:9-77)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2qb9e2: 2qb9 E:9-77 [150332]
   Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1
   automatically matched to 2AVY E:9-77
   complexed with lll, mg

Details for d2qb9e2

PDB Entry: 2qb9, 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2qb9e2:

Sequence; same for both SEQRES and ATOM records:

>d2qb9e2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2qb9e2:

• d2qb9e2 is new in SCOP 1.75
  
• d2qb9e2 appears in SCOPe 2.01
  
• d2qb9e2 appears in the current release, SCOPe 2.08