Lineage for d2qb9e1 (2qb9 E:78-158)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853027Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 853030Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
    Uniprot P0A7W1 78-158
  8. 853043Domain d2qb9e1: 2qb9 E:78-158 [150331]
    Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1
    automatically matched to 2AVY E:78-158
    complexed with lll, mg

Details for d2qb9e1

PDB Entry: 2qb9 (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2qb9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb9e1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

SCOP Domain Coordinates for d2qb9e1:

Click to download the PDB-style file with coordinates for d2qb9e1.
(The format of our PDB-style files is described here.)

Timeline for d2qb9e1: