SCOPe 2.06: Domain d2qb0c_: 2qb0 C:

Lineage for d2qb0c_ (2qb0 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)

7. Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)

8. Domain d2qb0c_: 2qb0 C: [150325]
   automated match to d1ji7a_
   complexed with mn

Details for d2qb0c_

PDB Entry: 2qb0, 2.56 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.

PDB Compounds: (C:) E80-TELSAM domain

SCOPe Domain Sequences for d2qb0c_:

Sequence; same for both SEQRES and ATOM records:

>d2qb0c_ a.60.1.1 (C:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq

Timeline for d2qb0c_:

• d2qb0c_ first appeared in SCOP 1.75, called d2qb0c1
  
• d2qb0c_ appears in SCOPe 2.05
  
• d2qb0c_ appears in SCOPe 2.07
  
• d2qb0c_ appears in the current release, SCOPe 2.08